DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc6a

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:60 Identity:35/60 - (58%)
Similarity:44/60 - (73%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            |..|:.|..:|:.|..:||.||.::.||||.||.|||.||.|||||:|:||||||||.|:
Zfish   140 SDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 33/55 (60%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128
Homeodomain 143..199 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 35/60 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.