DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxb3a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571192.2 Gene:hoxb3a / 30339 ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio


Alignment Length:127 Identity:47/127 - (37%)
Similarity:70/127 - (55%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SASSSYADYNKLETN---WCNEANDQWLQ-NEAPTGQELPSQRS----KLRAISSNRKERTAFSK 95
            |.|||.|....|...   |..|:.....| |.:|:.....::.|    .....:::::.|||::.
Zfish   125 SKSSSMATNPTLTKQIFPWMKESRQNTKQKNSSPSASSANAESSGGEKSPPGSAASKRARTAYTS 189

  Fly    96 TQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKTP 157
            .||.:||.||.::.||.|.||.|:|..|.|:|||:|:||||||||.|:.:..:..|||:..|
Zfish   190 AQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKSKGIGSSSGGP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
hoxb3aNP_571192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..135 5/9 (56%)
Antp-type hexapeptide 140..145 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..184 4/36 (11%)
Homeobox 184..236 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..290 4/15 (27%)
DUF4074 353..415 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.