DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment btn and hoxb2a

DIOPT Version :9

Sequence 1:	NP_732768.1	Gene:	btn / 42664	FlyBaseID:	FBgn0014949	Length:	158	Species:	Drosophila melanogaster
Sequence 2:	NP_571191.1	Gene:	hoxb2a / 30338	ZFINID:	ZDB-GENE-990415-103	Length:	390	Species:	Danio rerio

Alignment Length:	103	Identity:	46/103 - (44%)
Similarity:	63/103 - (61%)	Gaps:	14/103 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    70 GQELPSQ-RSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVW 133
            |.|.|:: :..|..:|.:|:.|||::.|||.:||.||.::.||.|.||.|||..|:|||||||||
Zfish   141 GLESPTEIQGGLDNVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVW 205

  Fly   134 FQNRRMKCKRIKLEEQ-------------QGSSAKTPF 158
            |||||||.||.....:             :|:.|.:|:
Zfish   206 FQNRRMKHKRQTTHHRDGQEGEPSGFDLLEGTDASSPY 243

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
btn	NP_732768.1	Homeobox	90..142	CDD:278475	35/51 (69%)
hoxb2a	NP_571191.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	40..73
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	81..100
		Antp-type hexapeptide	103..108
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	108..155		4/13 (31%)
		Homeobox	162..214	CDD:278475	35/51 (69%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	211..338		7/33 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000007
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.810