DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxb1a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571190.2 Gene:hoxb1a / 30337 ZFINID:ZDB-GENE-990415-101 Length:316 Species:Danio rerio


Alignment Length:144 Identity:50/144 - (34%)
Similarity:66/144 - (45%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQEL--------PSQRSKLR--AISSNRKERT 91
            ||..:.|...|..|..:...|.:    .::.|.|:..        |.:..|:.  .:......||
Zfish   167 DHQRAYSQGTYADLSASQGTEKD----TDQPPPGKTFDWMKVKRNPPKTGKVAEYGLGPQNTIRT 227

  Fly    92 AFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIK----------- 145
            .|:..||.:||.||.:|.||||.||.|||..|||.|.|||:||||||||.|:.:           
Zfish   228 NFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREKEGLAPASSTS 292

  Fly   146 ---LEEQQGSSAKT 156
               ||:|...|..|
Zfish   293 SKDLEDQSDHSTST 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 34/51 (67%)
hoxb1aNP_571190.2 Homeobox 226..278 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.