powered by:
Protein Alignment btn and hoxa2b
DIOPT Version :9
Sequence 1: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571181.1 |
Gene: | hoxa2b / 30325 |
ZFINID: | ZDB-GENE-990415-98 |
Length: | 363 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 41/74 - (55%) |
Similarity: | 51/74 - (68%) |
Gaps: | 1/74 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 SNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR-IKLEE 148
:.|:.|||::.|||.:||.||.::.||.|.||.|||..|:||||||||||||||||.|| .:.:|
Zfish 132 ATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKE 196
Fly 149 QQGSSAKTP 157
......|.|
Zfish 197 NHHGDGKPP 205
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.