DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxa2b

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:74 Identity:41/74 - (55%)
Similarity:51/74 - (68%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR-IKLEE 148
            :.|:.|||::.|||.:||.||.::.||.|.||.|||..|:||||||||||||||||.|| .:.:|
Zfish   132 ATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKE 196

  Fly   149 QQGSSAKTP 157
            ......|.|
Zfish   197 NHHGDGKPP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 35/51 (69%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 41/74 (55%)
Antp-type hexapeptide 88..93
Homeobox 137..189 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.