DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Meox2

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:128 Identity:63/128 - (49%)
Similarity:80/128 - (62%) Gaps:31/128 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ANDQWLQNEAPTG----------QEL-PSQ-----RSKLRAISSN--------------RKERTA 92
            :|...|.:..|||          |.| |::     .||.::.||:              ||||||
  Rat   128 SNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTA 192

  Fly    93 FSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            |:|.|:::|||||.:.|||||||||||||.|:||||||||||||||||.||:| ..|||::|:
  Rat   193 FTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK-GGQQGAAAR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 15/62 (24%)
Homeobox 190..243 CDD:395001 41/52 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354524
Domainoid 1 1.000 96 1.000 Domainoid score I7135
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44532
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.