DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Pdx1

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:72 Identity:37/72 - (51%)
Similarity:53/72 - (73%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQ 150
            |::.|||:::.||.:||.||.::.|::|.||.|:||.|.||||.:|:||||||||.|:   ||.:
Mouse   147 NKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKK---EEDK 208

  Fly   151 GSSAKTP 157
            ..|:.||
Mouse   209 KRSSGTP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 30/55 (55%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116
Antp-type hexapeptide 119..124
Homeodomain 148..204 CDD:459649 30/55 (55%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.