DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and dsc-1

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:72 Identity:27/72 - (37%)
Similarity:38/72 - (52%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PSQRSKLRAIS--SNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
            ||..|...|.|  ..|:.||.|::.|...||..|..|:|.....:..:|..|::.|.::.|||||
 Worm   166 PSLMSSDNAQSCGGRRRFRTNFTELQSTFLEDSFKESHYPDHKAKKYMADFLKIPEDRITVWFQN 230

  Fly   137 RRMKCKR 143
            ||.|.:|
 Worm   231 RRAKWRR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 21/55 (38%)
dsc-1NP_510497.1 Homeodomain 181..237 CDD:459649 21/55 (38%)

Return to query results.
Submit another query.