DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Nkx2-2

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:131 Identity:40/131 - (30%)
Similarity:54/131 - (41%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WLNQTEGYTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRA---- 82
            ||..|||   ..|.....|:|:             ...|...::..|:..|.|....:.:.    
Mouse    76 WLASTEG---LQYSLHGLAASA-------------PPQDSSSKSPEPSADESPDNDKETQGGGGD 124

  Fly    83 ISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLE 147
            ....||.|..|||.|..:||..|....||:...|..:|..:.||..|||:||||.|.|.||.:.|
Mouse   125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAE 189

  Fly   148 E 148
            :
Mouse   190 K 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 25/55 (45%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 7/52 (13%)
Homeodomain 129..185 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.