DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and mab-5

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:125 Identity:43/125 - (34%)
Similarity:66/125 - (52%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VYDHSASSSYADYNKLETNWCNEANDQWLQNE-APTGQELPSQRSKLRAIS-------------- 84
            :|:|:..::..  :.|...|.:.:::.:..|. ..|.......|:.:.|||              
 Worm    52 LYNHTYMNNMK--HMLAAGWMDNSSNPFAYNPLQATSANFGETRTSMPAISQPVFPWMKMGGAKG 114

  Fly    85 -SNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
             .:::.|..:|::|..:||.||.|..||||.||.||:..|.|||||||:||||||||.|:
 Worm   115 GESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3904
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.