DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and DLX3

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:155 Identity:47/155 - (30%)
Similarity:68/155 - (43%) Gaps:32/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QTEGYTDCSYVYDH-------SASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQ------ 76
            |..|.|...|.|.|       :.:.:|:.  |.|..:    ...:.|..|...|.||:|      
Human    54 QPYGQTVNPYTYHHQFNLNGLAGTGAYSP--KSEYTY----GASYRQYGAYREQPLPAQDPVSVK 112

  Fly    77 ---RSKLRAISSN----RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWF 134
               .:::|.::..    ||.||.:|..||..|:..|..:.||....|.|:|..|.||:.|||:||
Human   113 EEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWF 177

  Fly   135 QNRRMKCKR------IKLEEQQGSS 153
            ||||.|.|:      :.||....:|
Human   178 QNRRSKFKKLYKNGEVPLEHSPNNS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 27/55 (49%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567 14/58 (24%)
COG5576 <109..232 CDD:227863 32/94 (34%)
homeobox 129..188 28/58 (48%)
Homeodomain 130..186 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.