DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Meox2

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus


Alignment Length:97 Identity:57/97 - (58%)
Similarity:69/97 - (71%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAPTGQELPSQRS-------KLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVAL 123
            |..:|.:..|..|       |....|..|||||||:|.|:::|||||.:.|||||||||||||.|
Mouse   159 EKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNL 223

  Fly   124 ELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            :||||||||||||||||.||:| ..|||::|:
Mouse   224 DLTERQVKVWFQNRRMKWKRVK-GGQQGAAAR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 9/31 (29%)
Homeobox 190..242 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850808
Domainoid 1 1.000 96 1.000 Domainoid score I7305
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42469
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5370
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.