DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxd8

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_032302.2 Gene:Hoxd8 / 15437 MGIID:96209 Length:289 Species:Mus musculus


Alignment Length:137 Identity:49/137 - (35%)
Similarity:70/137 - (51%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YCYEDITKS--WLNQTEG----YTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQ 71
            |.|:::.:.  :..|.|.    |.||.     |:|.:           ..|..|...|:.:|: |
Mouse   135 YGYDNLQRQPIFTTQQEAELVQYPDCK-----SSSGN-----------IGEDPDHLNQSSSPS-Q 182

  Fly    72 ELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
            ..|..|.  :|....|:.|..:|:.|..:||.||.::.||||.||.|::..|.|||||||:||||
Mouse   183 MFPWMRP--QAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTERQVKIWFQN 245

  Fly   137 RRMKCKR 143
            ||||.|:
Mouse   246 RRMKWKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
Hoxd8NP_032302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..125
COG5576 139..272 CDD:227863 47/133 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..184 7/33 (21%)
Antp-type hexapeptide 183..188 1/4 (25%)
Homeobox 199..251 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..289 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.