DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxd8

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_032302.2 Gene:Hoxd8 / 15437 MGIID:96209 Length:289 Species:Mus musculus


Alignment Length:137 Identity:49/137 - (35%)
Similarity:70/137 - (51%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YCYEDITKS--WLNQTEG----YTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQ 71
            |.|:::.:.  :..|.|.    |.||.     |:|.:           ..|..|...|:.:|: |
Mouse   135 YGYDNLQRQPIFTTQQEAELVQYPDCK-----SSSGN-----------IGEDPDHLNQSSSPS-Q 182

  Fly    72 ELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
            ..|..|.  :|....|:.|..:|:.|..:||.||.::.||||.||.|::..|.|||||||:||||
Mouse   183 MFPWMRP--QAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTERQVKIWFQN 245

  Fly   137 RRMKCKR 143
            ||||.|:
Mouse   246 RRMKWKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 31/55 (56%)
Hoxd8NP_032302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..125
COG5576 139..272 CDD:227863 47/133 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..184 7/33 (21%)
Antp-type hexapeptide 183..188 1/4 (25%)
Homeodomain 196..252 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..289 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.