DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxd3

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:106 Identity:46/106 - (43%)
Similarity:61/106 - (57%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SASSSYADYNKLETNWCNEANDQWLQ-NEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLE 102
            |||||.:..:|....|..|:.....| |...|..|....:|.....|  ::.|||::..||.:||
Mouse   149 SASSSSSTISKQIFPWMKESRQNSKQKNSCATSGENCEDKSPPGPAS--KRVRTAYTSAQLVELE 211

  Fly   103 AEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            .||.::.||.|.||.|:|..|.|||||:|:||||||||.|:
Mouse   212 KEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 14/50 (28%)
Antp-type hexapeptide 161..166 1/4 (25%)
Homeobox 199..251 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.