DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxd11

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_032299.1 Gene:Hoxd11 / 15431 MGIID:96203 Length:336 Species:Mus musculus


Alignment Length:87 Identity:32/87 - (36%)
Similarity:55/87 - (63%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTER 128
            :.|.|.|:....:.....|...:||:|..::|.|:::||.||.::.|:.:.:|.:::..|.||:|
Mouse   242 EGEGPPGEAGAEKSGGTVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDR 306

  Fly   129 QVKVWFQNRRMKCKRIKLEEQQ 150
            |||:||||||||.|::..:..|
Mouse   307 QVKIWFQNRRMKEKKLNRDRLQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 26/55 (47%)
Hoxd11NP_032299.1 DUF3528 26..187 CDD:432284
Homeodomain 265..321 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.