DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxb8

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034591.1 Gene:Hoxb8 / 15416 MGIID:96189 Length:243 Species:Mus musculus


Alignment Length:115 Identity:46/115 - (40%)
Similarity:64/115 - (55%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YADYNKLETNWCNEANDQWLQNEAPTGQELPSQRS-----KLRAISSNRKERTAFSKTQLKQLEA 103
            |||        |..|....|..||...::.||...     :.:|.:..|:.|..:|:.|..:||.
Mouse   107 YAD--------CKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEK 163

  Fly   104 EFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSS 153
            ||.::.||||.||.|::.||.|||||||:||||||||.|:...:::..||
Mouse   164 EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 32/55 (58%)
Hoxb8NP_034591.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeodomain 147..203 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 2/11 (18%)

Return to query results.
Submit another query.