DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxb7

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:107 Identity:38/107 - (35%)
Similarity:54/107 - (50%) Gaps:29/107 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQL 101
            |.:|.|::..|             .|:::..|                ..::.|..:::.|..:|
Mouse   117 DLAAESNFRIY-------------PWMRSSGP----------------DRKRGRQTYTRYQTLEL 152

  Fly   102 EAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            |.||.|:.||||.||.|||..|.|||||:|:||||||||.|:
Mouse   153 EKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 2/17 (12%)
Homeobox 141..194 CDD:365835 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.