DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxb4

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:57 Identity:34/57 - (59%)
Similarity:46/57 - (80%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            ::.|||:::.|:.:||.||.|:.||||.||.|||.||.|:|||:|:||||||||.|:
Mouse   162 KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 33/55 (60%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Antp-type hexapeptide 140..145
Homeodomain 162..218 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 34/57 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.