DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxa6

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:60 Identity:34/60 - (56%)
Similarity:44/60 - (73%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            |..|:.|..:::.|..:||.||.::.||||.||.|||.||.|||||:|:||||||||.|:
Mouse   152 SHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 32/55 (58%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126
Antp-type hexapeptide 135..140
Homeodomain 155..211 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.