DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxa3

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:116 Identity:42/116 - (36%)
Similarity:61/116 - (52%) Gaps:29/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WCNEANDQWLQ-------------NEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEF 105
            |..|:.....|             :::|.||            :|:::.|||::..||.:||.||
Mouse   159 WMKESRQNTKQKTSGSSSGESCAGDKSPPGQ------------ASSKRARTAYTSAQLVELEKEF 211

  Fly   106 CYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKT 156
            .::.||.|.||.|:|..|.|||||:|:||||||||.|:    :|:|....|
Mouse   212 HFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK----DQKGKGMLT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151
Antp-type hexapeptide 156..161 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 5/45 (11%)
COG5576 <182..309 CDD:227863 39/93 (42%)
Homeobox 196..249 CDD:365835 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 4/15 (27%)
DUF4074 378..441 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.