DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxa1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus


Alignment Length:130 Identity:46/130 - (35%)
Similarity:68/130 - (52%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YDHSASSSYADYNKLETNWCNEAND-----QWL---QNEAPTGQELPSQRSKLRAISSNRKERTA 92
            |::|.|..:|.:.:...:..:|.:.     .|:   :|...||:.     .:...:......||.
Mouse   177 YNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKV-----GEYGYVGQPNAVRTN 236

  Fly    93 FSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKTP 157
            |:..||.:||.||.::.||||.||.|||.:|:|.|.|||:||||||||.|:.:.|.....|..||
Mouse   237 FTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP 301

  Fly   158  157
            Mouse   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 41/114 (36%)
Homeobox 234..287 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.