DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxa1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:130 Identity:46/130 - (35%)
Similarity:68/130 - (52%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YDHSASSSYADYNKLETNWCNEAND-----QWL---QNEAPTGQELPSQRSKLRAISSNRKERTA 92
            |::|.|..:|.:.:...:..:|.:.     .|:   :|...||:.     .:...:......||.
  Rat   175 YNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKV-----GEYGYVGQPNAVRTN 234

  Fly    93 FSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKTP 157
            |:..||.:||.||.::.||||.||.|||.:|:|.|.|||:||||||||.|:.:.|.....|..||
  Rat   235 FTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP 299

  Fly   158  157
              Rat   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 5/26 (19%)
COG5576 175..>285 CDD:227863 41/114 (36%)
Antp-type hexapeptide 203..208 1/4 (25%)
Homeobox 232..284 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.