DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and alx1

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_002931669.1 Gene:alx1 / 100489661 XenbaseID:XB-GENE-853095 Length:326 Species:Xenopus tropicalis


Alignment Length:41 Identity:11/41 - (26%)
Similarity:21/41 - (51%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLAR--QLVERKLVACVNIIPGLTSIYSWEDKINED---PE 97
            ::||  :|.|||....:..:|..:.::  :|.:..|   ||
 Frog   291 EIARFYKLHERKCEPIIMTVPRKSDLF--QDDLYPDTPGPE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 4/14 (29%)
alx1XP_002931669.1 Homeodomain 133..189 CDD:459649
OAR 302..320 CDD:461067 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.