DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc4

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_002936684.1 Gene:hoxc4 / 100486039 XenbaseID:XB-GENE-967141 Length:297 Species:Xenopus tropicalis


Alignment Length:115 Identity:42/115 - (36%)
Similarity:65/115 - (56%) Gaps:24/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAPTGQELPSQRSK------------LRAISSN------RKERTAFSKTQLKQLEAEFCYSNYLT 112
            :|||.:...:..||            :.:::.|      ::.|||:::.|:.:||.||.|:.|||
 Frog   155 QAPTSEHPTNTASKQPIVYPWMKKIHVSSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHYNRYLT 219

  Fly   113 RLRRYEIAVALELTERQVKVWFQNRRMKCKR------IKLEEQQGSSAKT 156
            |.||.|||.:|.|:|||:|:||||||||.|:      .|:.....|:|.:
 Frog   220 RRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSNASSNASS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
hoxc4XP_002936684.1 Homeobox 196..250 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.