DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc3

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:92 Identity:38/92 - (41%)
Similarity:58/92 - (63%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WCNEA--NDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116
            |..|.  |.:..:...|...:.|:..|...: |::::.|||::.:||.:||.||.::.||.|.||
 Frog   130 WMKETRQNSKQKKQAPPPADDAPAVDSSFLS-SASKRARTAYTNSQLVELEKEFHFNRYLCRPRR 193

  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKR 143
            .|:|..|.|:|||:|:||||||||.|:
 Frog   194 LEMAKLLNLSERQIKIWFQNRRMKFKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 30/52 (58%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.