DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and meox2

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001116898.1 Gene:meox2 / 100144655 XenbaseID:XB-GENE-852818 Length:300 Species:Xenopus tropicalis


Alignment Length:186 Identity:71/186 - (38%)
Similarity:96/186 - (51%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HANVYQESYCYEDITKSW-----------------LNQTEGYTDCSYVYDHSASSSYADYNKLET 52
            |.:.:.:...::.:..:|                 |.|..|..|.|    .|.|...::.:.|.|
 Frog    73 HHHHHHQQQQHQTLQSNWHIPQMSSPPASTRHSLCLQQESGPPDLS----GSPSILCSNTSSLGT 133

  Fly    53 NWCNEA----NDQWLQNEAPTGQELPSQRSKLRAISSN--------------RKERTAFSKTQLK 99
            |....|    .|...|..:|.  |...:..|.::.||:              |||||||:|.|::
 Frog   134 NSSTGAACVTGDYGRQTLSPA--EAEKRTGKRKSDSSDSQEGSYKSDVNSKPRKERTAFTKEQIR 196

  Fly   100 QLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            :|||||.:.|||||||||||||.|:||||||||||||||||.||:| ..|||::|:
 Frog   197 ELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK-GGQQGAAAR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
meox2NP_001116898.1 COG5576 157..269 CDD:227863 54/96 (56%)
Homeobox 187..240 CDD:365835 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7233
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102407
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5370
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.