DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph5 and dph5

DIOPT Version :9

Sequence 1:NP_524452.4 Gene:Dph5 / 42663 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001005058.1 Gene:dph5 / 448611 XenbaseID:XB-GENE-965468 Length:290 Species:Xenopus tropicalis


Alignment Length:284 Identity:173/284 - (60%)
Similarity:212/284 - (74%) Gaps:7/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYGRPLLLADRDLVEQGA 65
            |.|||||||||.||:||||||:::.|:|||||.|||||....|.::|||||.|:||||:.|||.|
 Frog     1 MLYLIGLGLGDEKDVTVKGLEVIRSCARVYLEAYTSILTVRKETLEEFYGRELILADRETVEQEA 65

  Fly    66 DEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLYKFGET 130
            ||||..|..|||||||||||||||||:|.||||.:..|.:.|||||||:.||||||||||.||||
 Frog    66 DEILRDAAVSDVALLVVGDPFGATTHSDLILRAAKAGIQHHVIHNASILTAVGCCGLQLYNFGET 130

  Fly   131 VSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAAH 195
            |||.:|.:||||:||||||:.|||..|||||||||||||.:.|:||:..|.:.|||:|||.:|..
 Frog   131 VSIVFWTDTWKPESFYDKIRRNRLSGMHTLCLLDIKVKEQSIENLMKGNKAFEPPRYMTVNQAVD 195

  Fly   196 QLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLIIPAKEMH 260
            |||.||:.:..|.:...|.|.::|.||||||...|:|:.|||.::.|.|.|||||||:|... ||
 Frog   196 QLLEIVQNRRELGEELALTENTICAGLARVGASDQKISAGTLQQLSSVDFGGPLHSLVISGC-MH 259

  Fly   261 PLEVEFLQQYA------PSIKLDD 278
            |||::.|:.:|      ..|.::|
 Frog   260 PLELDMLKLFAVEQSTFEQINIED 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 170/268 (63%)
dph5NP_001005058.1 PTZ00175 1..269 CDD:185500 170/268 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2113
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6471
Inparanoid 1 1.050 325 1.000 Inparanoid score I2450
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1018517at2759
OrthoFinder 1 1.000 - - FOG0005194
OrthoInspector 1 1.000 - - oto102388
Panther 1 1.100 - - LDO PTHR10882
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R340
SonicParanoid 1 1.000 - - X3707
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.