DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph5 and CG33107

DIOPT Version :9

Sequence 1:NP_524452.4 Gene:Dph5 / 42663 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_788717.1 Gene:CG33107 / 326256 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster


Alignment Length:166 Identity:32/166 - (19%)
Similarity:60/166 - (36%) Gaps:61/166 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFY---------LIGLGLGDLK---DITVKGLEIVKQC---SRVYLEMYTSILGCSLEDMQEFYG 50
            |||         :.|:|:..|:   |:......:|:.|   :.|.:.:..:|:|       .:.|
  Fly   114 MFYMASGLYENLITGVGMERLERVLDLQAAIPAMVESCHLGNDVAMALLLTIMG-------RYTG 171

  Fly    51 RPLLLADRDLVEQGAD-------EILAGAG-ESDVALLV------------------VGDPFGAT 89
            .|:.|..::...:..:       ..||.:| ::|:.:|:                  ..|..||.
  Fly   172 EPVELDQKEYALKAFEMAKTVNWRQLANSGRQADLFMLIRTFSMIINCRRIREECPDWKDNLGAE 236

  Fly    90 THTDFI-LRAK------------EKNIPYKVIHNAS 112
            .|..|: :|..            |:.|.|.|:..||
  Fly   237 IHKYFLQVRMDHSAAYGDFEMMIERFIAYCVVRGAS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 32/166 (19%)
CG33107NP_788717.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1798
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.