DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6937 and PABPN1L

DIOPT Version :10

Sequence 1:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001372638.1 Gene:PABPN1L / 390748 HGNCID:37237 Length:297 Species:Homo sapiens


Alignment Length:131 Identity:28/131 - (21%)
Similarity:58/131 - (44%) Gaps:33/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TINEDSDDEDYVDASDDESDL-----EAEEEQADSEQTSDDSD----------EEEDLS--PPPK 296
            |::.|.:.:.:...::.:..|     |.:||:.:.|...:|.|          |:|:|:  |.|.
Human    20 TVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLSLLEQENLAECPLPD 84

  Fly   297 QK----KTKLA--DKLKRKPGTGGVQKKKIAPPAKSNKNAATQKLQLAAAKSLAKPL---PKGKA 352
            |:    |.|:.  ::.:..|...|||:       ::.:...|...||.:.:::..||   |:.|.
Human    85 QELEAIKMKVCAMEQAEGTPRPPGVQQ-------QAEEEEGTAAGQLLSPETVGCPLSGTPEEKV 142

  Fly   353 K 353
            :
Human   143 E 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6937NP_651066.2 RRM_NIFK_like 52..125 CDD:409748
RRN3 <242..>306 CDD:461623 17/79 (22%)
PABPN1LNP_001372638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..66 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.