DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and psmd14

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001077042.1 Gene:psmd14 / 799058 ZFINID:ZDB-GENE-070410-56 Length:310 Species:Danio rerio


Alignment Length:169 Identity:31/169 - (18%)
Similarity:66/169 - (39%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSAKPSTSSSAAAGSSMAVDKTADQNPQPQGNIMAAAGTSGSVTISLHPLVIMNISEHWTRFRAQ 74
            :|..|.|       .::||| ||:|                   :.:..|.::.:.:|     .:
Zfish    14 LSQGPPT-------DALAVD-TAEQ-------------------VYISSLALLKMLKH-----GR 46

  Fly    75 HGEPRQVYGALIGK-QKGRNIEIMNSFELKTDVIG-DETVINKDYYNKKEQQYKQVFSDLDFIGW 137
            .|.|.:|.|.::|: .....:.:::.|.:.....| ....::..:..|.....||.......:||
Zfish    47 AGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGW 111

  Fly   138 YTTGDNP------TADDIKIQRQIAAINECPIMLQLNPL 170
            |.:  :|      :..||..|:...|::|..:.:.::|:
Zfish   112 YHS--HPGFGCWLSGVDINTQQSFEALSERAVAVVVDPI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 22/127 (17%)
psmd14NP_001077042.1 MPN_RPN11_CSN5 25..286 CDD:163700 27/151 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.