DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and psmd14

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001025636.1 Gene:psmd14 / 595024 XenbaseID:XB-GENE-950703 Length:310 Species:Xenopus tropicalis


Alignment Length:134 Identity:27/134 - (20%)
Similarity:57/134 - (42%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AAGTSGSVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGK-QKGRNIEIMNSFELKTDVIG 108
            |..|:..|.||  .|.::.:.:|     .:.|.|.:|.|.::|: .....:.:::.|.:.....|
 Frog    24 AVDTAEQVYIS--SLALLKMLKH-----GRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTG 81

  Fly   109 -DETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQRQIAAINECPIMLQ 166
             ....::..:..|.....||.......:|||.:  :|      :..||..|:...|::|..:.:.
 Frog    82 VSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHS--HPGFGCWLSGVDINTQQSFEALSERAVAVV 144

  Fly   167 LNPL 170
            ::|:
 Frog   145 VDPI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 25/127 (20%)
psmd14NP_001025636.1 MPN_RPN11_CSN5 21..286 CDD:163700 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.