DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and cops6

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001017768.1 Gene:cops6 / 550465 ZFINID:ZDB-GENE-050417-289 Length:297 Species:Danio rerio


Alignment Length:297 Identity:181/297 - (60%)
Similarity:239/297 - (80%) Gaps:1/297 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AAGTSGSVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGD 109
            |:|.:|||:::||||||:|||:||.|.|:|.|...||.|||||||:|||||:||||||....:.|
Zfish     2 ASGVTGSVSVALHPLVILNISDHWIRIRSQEGRAVQVVGALIGKQEGRNIEVMNSFELLFHTVED 66

  Fly   110 ETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSV 174
            :..|:|:||..||:|:||||.:::|:||||||.:|...||.|.:|:..|.|.|:.|:|||:::..
Zfish    67 QIHIDKEYYYTKEEQFKQVFKEMEFLGWYTTGGSPDQSDIHIHKQVCEIIESPLFLKLNPMTKHT 131

  Fly   175 DHLPLKLFESLIDLVDGEATMLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQD 239
            | ||:.:|||:||::.|||||||..|.||||||||||||||||||||:..:||.|.|||||:||.
Zfish   132 D-LPVSVFESVIDIISGEATMLFAELPYTLATEEAERIGVDHVARMTATGTGENSTVAEHLIAQH 195

  Fly   240 SAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDVGLIS 304
            ||||||::|:|::|:|::.|:||::..|.||||||.||||||||:....|:.:||.|||||||::
Zfish   196 SAIKMLHSRVKVILEYVKAVQAGEVPFNHEILREANALCHRLPVLNTLKFKTDFYDQCNDVGLMA 260

  Fly   305 YLGTLTKGCNDMHHFVNKFNMLYDRQGSARRMRGLYY 341
            ||||:||.||.|:.|:||||:||||||..||||||::
Zfish   261 YLGTITKTCNSMNQFINKFNVLYDRQGIGRRMRGLFF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 171/282 (61%)
cops6NP_001017768.1 MPN_CSN6 9..291 CDD:163694 171/282 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4977
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.