DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and eif3f

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001016190.1 Gene:eif3f / 548944 XenbaseID:XB-GENE-5898648 Length:285 Species:Xenopus tropicalis


Alignment Length:284 Identity:74/284 - (26%)
Similarity:132/284 - (46%) Gaps:26/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MAAAGT---SGSV-----TISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNS 99
            |||||:   :||.     .:.:||:|:.:|.:.:.|.....|   :|.|.|:|.....::|:.|.
 Frog     1 MAAAGSLSAAGSAMLHGPVVKVHPVVLASIVDSYERRNEGAG---RVIGTLLGTTDKHSVEVTNC 62

  Fly   100 FELKTDVIGDETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIM 164
            |.:..:...||..::.::.....:.:|:|.|....:|||.||::.|...:       .|:|....
 Frog    63 FSVPHNESEDEVAVDMEFAKNMYELHKKVTSTEQIVGWYATGNDITEHSV-------LIHEYYSR 120

  Fly   165 LQLNPLSRSVD------HLPLKLFESLIDLVDGEAT-MLFVPLTYTLATEEAERIGVDHVARMTS 222
            ...||:..:||      .:.:|.:.|....|.|:.. ::|.|||......:.||||||.:.:..:
 Frog   121 EATNPIHMTVDTSLQGNRMNIKAYISSPMGVPGKTMGVMFTPLTVQYVYYDTERIGVDLITKTCA 185

  Fly   223 NESGEKSVVAEHLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVP 287
            |.:....:..: |.....|...|...:..||||..||.:||:.|:..:.|....|..::|.:...
 Frog   186 NPNRSIGLTTD-LQQVGVAANRLQDSLSTVLQYAEDVLSGKVTADNTVGRFLMDLVTQVPKIDPE 249

  Fly   288 AFQEEFYTQCNDVGLISYLGTLTK 311
            .|:....:..||:.:::||..||:
 Frog   250 DFEAMLNSNINDLLMVTYLANLTQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 67/272 (25%)
eif3fNP_001016190.1 MPN_eIF3f 20..282 CDD:163695 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.