DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and CSN5

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster


Alignment Length:279 Identity:54/279 - (19%)
Similarity:98/279 - (35%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK--- 115
            |.:..|.::.:..|     |:.|...:|.|.::||.:...:.:|::|.|..:  |.||.:|.   
  Fly    52 IKISALALLKMVMH-----ARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVE--GTETRVNAQAQ 109

  Fly   116 --DYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQ------------------RQ 154
              :|.....:..|:|......:|||.:  :|      :..|:..|                  |.
  Fly   110 AYEYMTAYMEAAKEVGRMEHAVGWYHS--HPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRT 172

  Fly   155 IAA-----------------INECPIMLQLNPLSRSVD-------HLPLKL--FESLID--LVDG 191
            ::|                 .||.|...|..||::..|       :.||::  |:|.:|  |:|.
  Fly   173 VSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDS 237

  Fly   192 ----------EATMLFVPLTYTL-------------------ATEEAERIGVDHVARMTSNESGE 227
                      .::.|.....||.                   .|:..|:...|.:::.|.:.|..
  Fly   238 LWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRS 302

  Fly   228 KSVVAEHLVAQDSAIKMLN 246
            ...:...|:||....|:.|
  Fly   303 TIELIHGLMAQIVKDKLFN 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 54/279 (19%)
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 49/261 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.