DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and cops5

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_957019.1 Gene:cops5 / 393698 ZFINID:ZDB-GENE-040426-1686 Length:334 Species:Danio rerio


Alignment Length:340 Identity:71/340 - (20%)
Similarity:113/340 - (33%) Gaps:124/340 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AGSSMA---------------VDKTADQNPQPQGNIMAAAGTSGS----VTISLHPLVIMNISEH 67
            ||||:|               :|:....:.:.|..|:||...:..    ....|..|.::.:..|
Zfish     2 AGSSIAMKTWELSNSMQEVQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKLSALALLKMVMH 66

  Fly    68 WTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK-----DYYNKKEQQYKQ 127
                 |:.|...:|.|.::||..|..:.||:||.|..:  |.||.:|.     :|.....:..||
Zfish    67 -----ARSGGNLEVMGLMLGKVDGETMIIMDSFALPVE--GTETRVNAQAAAYEYMAAYIENAKQ 124

  Fly   128 VFSDLDFIGWYTTGDNP------TADDIKIQ------------------RQIAA--IN------- 159
            |....:.||||.:  :|      :..|:..|                  |.|:|  :|       
Zfish   125 VGRLENAIGWYHS--HPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTY 187

  Fly   160 --------ECPIMLQLNPLSRSVD------------------HLPLKLFESL------------- 185
                    |.|...|..||::..|                  .|..||.|.|             
Zfish   188 PKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSS 252

  Fly   186 ----IDLVDGEATMLFVPL----------TYTLATEEAERIGVDHVARMTSNESGEKSVVAEH-- 234
                .|...|:...|...|          ::.|..:..:|...|.:|:.| .:|.:.::.|.|  
Zfish   253 LLTNADYTTGQVFDLSEKLEQAEAQLGRGSFMLGLDTHDRKSEDKLAKAT-RDSCKTTIEAIHGL 316

  Fly   235 --LVAQDSAIKMLNT 247
              .|.:|.....:||
Zfish   317 MSQVIKDKLFNQVNT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 61/291 (21%)
cops5NP_957019.1 MPN_RPN11_CSN5 42..312 CDD:163700 55/279 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 136..149 1/14 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.