DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and Rpn8

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster


Alignment Length:291 Identity:74/291 - (25%)
Similarity:143/291 - (49%) Gaps:30/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNI-EIMNSFELKTDVIG-DETV--IN 114
            :.:||||::::.:|:.|. .:.|..::|.|.|:|..:.:.: ::.|||.:..|... |::|  ::
  Fly    11 VIVHPLVLLSVVDHFNRM-GKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLD 74

  Fly   115 KDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINE-----CP----IMLQLNPL 170
            .||.......:|:|.:....:|||.||.....:||       ||||     ||    :::...|.
  Fly    75 HDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDI-------AINELVRRYCPNSVLVIIDAKPK 132

  Fly   171 SRSVDHLPLKLFESLIDL-VDGEAT-MLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAE 233
            ...   ||.:.:.|:.:: .||..| ..|..:...:..||||.:||:|:.|...:.:  ...:::
  Fly   133 DLG---LPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTT--VGSLSQ 192

  Fly   234 HLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCN 298
            .:..|...:|.||.:::.:.||::.|...|:..|.:|:.:...:.:.||.:....|....|.:.|
  Fly   193 KITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTN 257

  Fly   299 DVGLISYLGTLTKGCNDMHHFVNKFNMLYDR 329
            |..|:.||.::.:....:|:.:|  |.|.:|
  Fly   258 DQMLVVYLASMVRSIIALHNLIN--NKLANR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 74/291 (25%)
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 74/291 (25%)
MPN_RPN7_8 9..290 CDD:163693 74/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.