DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and CG4751

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster


Alignment Length:90 Identity:21/90 - (23%)
Similarity:34/90 - (37%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QMEVDVDMSAKPSTSSSAAAGSSMAVDKTADQNPQPQGNIMAAAGTSGSVTISLHPLVIMNISEH 67
            |.:...|:.|..:|.|.|..|:.      :..|....|:....:|.||..:.|       ::|..
  Fly  1158 QNKAAADLDALFATPSGAVVGAG------SSANAMKSGSSAGNSGVSGMSSPS-------SLSNQ 1209

  Fly    68 WTRFRAQHGEPRQVYGALIGKQKGR 92
            ...:.|...|..|.|.|...:|.|:
  Fly  1210 AAYYNALAQEKMQDYAAFFQQQHGK 1234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 9/41 (22%)
CG4751NP_609495.1 MPN_2A_DUB 278..463 CDD:163698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.