DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and Brcc3

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001120772.1 Gene:Brcc3 / 316794 RGDID:1588543 Length:291 Species:Rattus norvegicus


Alignment Length:170 Identity:39/170 - (22%)
Similarity:69/170 - (40%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IGWYTTGDN----PTADDIKIQRQ--------IAAINECPI-------------MLQLNPLSRSV 174
            :|||.:..:    |:..|::.|..        :..|..|.|             ..|.....:|.
  Rat   118 VGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSVQAQKSS 182

  Fly   175 DHLPLKLFESLIDLVD-GEATM-LFVPLTYTLATEEAE---RI-GVDHVARMTSNESGEKSVVAE 233
            |:..:::...::..|. |:..: ..|.|...|..||.:   || .:.|:..:|...:|  ||..:
  Rat   183 DYERIEIPVHVVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNG--SVFTK 245

  Fly   234 HLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILRE 273
            :|.:|.||:.      ..:||::.|    :|..||:.|||
  Rat   246 NLCSQMSAVS------GPLLQWLED----RLEQNQQHLRE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 39/170 (23%)
Brcc3NP_001120772.1 MPN_BRCC36 13..270 CDD:163699 34/163 (21%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 122..135 1/12 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.