DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and Cops5

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001020866.1 Gene:Cops5 / 312916 RGDID:1310301 Length:334 Species:Rattus norvegicus


Alignment Length:352 Identity:71/352 - (20%)
Similarity:111/352 - (31%) Gaps:151/352 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAGSSMA---------------VDKTADQNPQPQGNIMAAAGTSGSVTISLHPLVIMNISEHWTR 70
            |:||.||               :|:....:.:.|..|:||                    :.||:
  Rat     3 ASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAA--------------------KPWTK 47

  Fly    71 -------------------FRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK- 115
                               ..|:.|...:|.|.::||..|..:.||:||.|..:  |.||.:|. 
  Rat    48 DHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVE--GTETRVNAQ 110

  Fly   116 ----DYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQ------------------ 152
                :|.....:..|||....:.||||.:  :|      :..|:..|                  
  Rat   111 AAAYEYMAAYIENAKQVGRLENAIGWYHS--HPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPT 173

  Fly   153 RQIAA--IN---------------ECPIMLQLNPLSRSVD------------------HLPLKLF 182
            |.|:|  :|               |.|...|..||::..|                  .|..||.
  Rat   174 RTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLL 238

  Fly   183 ESL-----------------IDLVDGEATMLFVPL----------TYTLATEEAERIGVDHVARM 220
            |.|                 .|...|:...|...|          ::.|..|..:|...|.:|:.
  Rat   239 ELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKA 303

  Fly   221 TSNESGEKSVVAEH-LVAQDSAIKMLN 246
            | .:|.:.::.|.| |::|....|:.|
  Rat   304 T-RDSCKTTIEAIHGLMSQVIKDKLFN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 61/306 (20%)
Cops5NP_001020866.1 MPN_RPN11_CSN5 44..314 CDD:163700 55/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.