DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and Psmd7

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001100896.1 Gene:Psmd7 / 307821 RGDID:1306902 Length:320 Species:Rattus norvegicus


Alignment Length:295 Identity:75/295 - (25%)
Similarity:147/295 - (49%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIG-DETV--INK 115
            :.:||||::::.:|:.|. .:.|..::|.|.|:|..:.:.:::.|||.:..|... |::|  ::.
  Rat     9 VVVHPLVLLSVVDHFNRI-GKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDH 72

  Fly   116 DYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINE-----CP----IMLQLNPLS 171
            ||.......:|:|.:....:|||.||.       |:.:...||||     ||    :::.:.|..
  Rat    73 DYLENMYGMFKKVNARERIVGWYHTGP-------KLHKNDIAINELMKRYCPNSVLVIIDVKPKD 130

  Fly   172 RSVDHLPLKLFESLIDL-VDGEAT-MLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEH 234
            ..   ||.:.:.|:.:: .||..| ..|..:|..:..||||.:||:|:.|...:.:  ...:::.
  Rat   131 LG---LPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTT--VGTLSQR 190

  Fly   235 LVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCND 299
            :..|...:|.||:::..:..|:..|.:|||..|..|:.:...:.:.||...:..|.:.||.:.||
  Rat   191 ITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTND 255

  Fly   300 VGLISYLGTLTKGCNDMHHFVNKFNMLYDRQGSAR 334
            ..::.||.:|.:....:|:.:|  |.:.:|....:
  Rat   256 QMVVVYLASLIRSVVALHNLIN--NKIANRDAEKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 75/295 (25%)
Psmd7NP_001100896.1 MPN_RPN7_8 7..285 CDD:163693 75/290 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.