DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and COPS5

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_006828.2 Gene:COPS5 / 10987 HGNCID:2240 Length:334 Species:Homo sapiens


Alignment Length:353 Identity:72/353 - (20%)
Similarity:112/353 - (31%) Gaps:151/353 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AAAGSSMA---------------VDKTADQNPQPQGNIMAAAGTSGSVTISLHPLVIMNISEHWT 69
            ||:||.||               :|:....:.:.|..|:||                    :.||
Human     2 AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAA--------------------KPWT 46

  Fly    70 R-------------------FRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK 115
            :                   ..|:.|...:|.|.::||..|..:.||:||.|..:  |.||.:|.
Human    47 KDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVE--GTETRVNA 109

  Fly   116 -----DYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQ----------------- 152
                 :|.....:..|||....:.||||.:  :|      :..|:..|                 
Human   110 QAAAYEYMAAYIENAKQVGRLENAIGWYHS--HPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDP 172

  Fly   153 -RQIAA--IN---------------ECPIMLQLNPLSRSVD------------------HLPLKL 181
             |.|:|  :|               |.|...|..||::..|                  .|..||
Human   173 TRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKL 237

  Fly   182 FESL-----------------IDLVDGEATMLFVPL----------TYTLATEEAERIGVDHVAR 219
            .|.|                 .|...|:...|...|          ::.|..|..:|...|.:|:
Human   238 LELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAK 302

  Fly   220 MTSNESGEKSVVAEH-LVAQDSAIKMLN 246
            .| .:|.:.::.|.| |::|....|:.|
Human   303 AT-RDSCKTTIEAIHGLMSQVIKDKLFN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 61/306 (20%)
COPS5NP_006828.2 MPN_RPN11_CSN5 44..314 CDD:163700 55/274 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 138..151 1/14 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.