DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN6 and STAMBP

DIOPT Version :9

Sequence 1:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001340896.1 Gene:STAMBP / 10617 HGNCID:16950 Length:424 Species:Homo sapiens


Alignment Length:89 Identity:23/89 - (25%)
Similarity:43/89 - (48%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LATEEAERIGVDHVARMTS-----NESGEKSVVAEHLVAQDSAI--KMLNTRIKIVLQYIRDVEA 261
            :|..:||.:..:.:.|.|.     ||  ||...||.| |::.||  ::...:.::..|..:.:|.
Human    98 IAFPKAEELKAELLKRYTKEYTEYNE--EKKKEAEEL-ARNMAIQQELEKEKQRVAQQKQQQLEQ 159

  Fly   262 GKLRANQEILREAYALCHRLPVMQ 285
            .:..|.:|::|.......||.::|
Human   160 EQFHAFEEMIRNQELEKERLKIVQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 23/89 (26%)
STAMBPNP_001340896.1 Interaction with CHMP3 1..127 9/30 (30%)
USP8_dimer 7..114 CDD:312504 3/15 (20%)
Interaction with STAM 227..231
MPN_AMSH_like 254..424 CDD:163697
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.