Sequence 1: | NP_524451.1 | Gene: | CSN6 / 42661 | FlyBaseID: | FBgn0028837 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005796.1 | Gene: | PSMD14 / 10213 | HGNCID: | 16889 | Length: | 310 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 42/253 - (16%) |
---|---|---|---|
Similarity: | 95/253 - (37%) | Gaps: | 53/253 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 AAGTSGSVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGK-QKGRNIEIMNSFELKTDVIG 108
Fly 109 -DETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQRQIAAINECPIMLQ 166
Fly 167 LNPL-----------------------------SRSVDHLPLKLFESLIDLVDGEATMLFVPLTY 202
Fly 203 TLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQDSAIKMLNTRIKIVLQYIRDVE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CSN6 | NP_524451.1 | MPN_CSN6 | 52..335 | CDD:163694 | 40/246 (16%) |
PSMD14 | NP_005796.1 | MPN_RPN11_CSN5 | 21..286 | CDD:163700 | 42/253 (17%) |
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 | 113..126 | 1/14 (7%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |