DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and AT1G75000

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_177637.1 Gene:AT1G75000 / 843838 AraportID:AT1G75000 Length:281 Species:Arabidopsis thaliana


Alignment Length:287 Identity:56/287 - (19%)
Similarity:105/287 - (36%) Gaps:82/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LMEHP-------------------MFT----FGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVY 103
            |.|||                   :||    :.:.||.|..:|:|.......|:.|.|.....::
plant     8 LAEHPTIVNFRWSPTQSYASTWSFLFTAVSSYIIAAVTLHLLLLITLSLSNRRRGFSLGPIPALH 72

  Fly   104 NAFQVALSGYMFYEHLMAG----------W-------LNYYNLKCQPVDYSDSPSSKRMLNLCYL 151
            :.....:|..:|...|::.          |       |.::  .|.||   .:.:|.|:....|.
plant    73 SLTISIISAVIFVGILLSAAAEIRDTRWLWRRTRTTALQWF--LCFPV---GTRASGRVFFWSYA 132

  Fly   152 YYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFL----AGGNATFPNLLNNFV 212
            :|||:......|.|.|:|::  ::::..:.:.|     :.:.:.||    :........||....
plant   133 FYLSRFLHLFRTFFSVIRRR--KLSFFQLINQS-----SLLCISFLWLEYSQSFQVVAILLTTVS 190

  Fly   213 HVCMYFYYMMAAMGPEYAKFLWWKK-------YMTELQIAQFVLCIFHTLRALFSNQCQ------ 264
            :..:|.|.....:|...|.|.:...       .||...:.  |||| |.::   ...|.      
plant   191 YAVVYGYRFWTEIGLRGACFPFVGNCQAILLGCMTVCHVG--VLCI-HLVK---RGGCNGIGAWL 249

  Fly   265 FSKFISALLLLNASIFFCLFMNFYMQS 291
            |:..::|::.|       |::.||.::
plant   250 FNSVLNAVITL-------LYLKFYCKT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 56/287 (20%)
AT1G75000NP_177637.1 ELO 26..276 CDD:395916 52/269 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.