DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and ELOVL3

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:263 Identity:76/263 - (28%)
Similarity:123/263 - (46%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PMF------TFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVA---LSGYMFYEHLMA 121
            |.|      :|.:..:||. ::.:|..:|::||.|.|:..|::: :|.:|   :.|.:....:|.
Human    28 PFFEEYWATSFPIALIYLV-LIAVGQNYMKERKGFNLQGPLILW-SFCLAIFSILGAVRMWGIMG 90

  Fly   122 GWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSVT 186
            ..|....|| |.|.:.:...:..:....:::.|||:.|..||.|.:|||:  .:.::|.||||. 
Human    91 TVLLTGGLK-QTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKR--PLIFIHWYHHST- 151

  Fly   187 PLETWVLV--------KFLAGGNATFPNLLNNF-VHVCMYFYYMMAAMGPEYAKFLWWKKYMTEL 242
                 |||        |..|||  .|..:  || ||..||.||.:.|...:..|.|  ...:|.|
Human   152 -----VLVYTSFGYKNKVPAGG--WFVTM--NFGVHAIMYTYYTLKAANVKPPKML--PMLITSL 205

  Fly   243 QIAQ-FVLCIFHTLRALFSNQ--CQFSK---FISALLLLNASIFFCLFMNFYMQSYRKTKAAQQL 301
            ||.| ||..|...|..::...  |..:.   |.|.:|.:.   :|.||.:|:.|:|.:.|...:.
Human   206 QILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMT---YFILFAHFFCQTYIRPKVKAKT 267

  Fly   302 QQQ 304
            :.|
Human   268 KSQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 74/251 (29%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 74/256 (29%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.