DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and HOS3-1

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:206 Identity:37/206 - (17%)
Similarity:72/206 - (34%) Gaps:52/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LMEHP-----------------MFTFGMVAVYL---SWVLVIGPLFMRDRKPFQLRRTLVVYNAF 106
            |.|||                 .|.|..:::|:   |.:.::.....|..:...|.....:::..
plant    13 LSEHPYIVGFRWSNSQSWGSTWSFLFTSISLYIAVSSSLHILLSAVRRSNRSVPLGHIPEIHSLL 77

  Fly   107 QVALSGYMFYEHLMAG---------------------WLNYYNLKCQPVDYSDSPSSKRMLNLCY 150
            ...||..:|...|::.                     ||..:.|..:|        |.|:....|
plant    78 MSILSATIFAGILLSAAAEIRDTRWLWRRSKTATPLQWLLCFPLGTRP--------SGRVFFWSY 134

  Fly   151 LYYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVC 215
            ::||::......|:|.|||.:...::.|  :.:||....:::.::| :........|....|:..
plant   135 VFYLTRFLHMFRTIFAVLRSRRLAVSQL--FCNSVMAFTSFLWLEF-SQSYQILAILSTTLVYSV 196

  Fly   216 MYFYYMMAAMG 226
            :|.|......|
plant   197 VYGYRFWTGFG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 37/206 (18%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.