DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and AT3G06460

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:292 Identity:75/292 - (25%)
Similarity:121/292 - (41%) Gaps:95/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LMEHP-----------------MFTFGMVAVYLSWVLV----------IGPLFMRDRKPFQLRRT 99
            |:.||                 .|.|.:|::|||...:          :||   |..||.....:
plant    12 LVHHPYIANFTWTEGETLGSTVFFVFVVVSLYLSATFLLRYTVDSLPTLGP---RILKPITAVHS 73

  Fly   100 LVVYNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLN-LCY------------- 150
            |::   |.::|:        ||       :.|.....|.|....|:.: :|:             
plant    74 LIL---FLLSLT--------MA-------VGCTLSLISSSDPKARLFDAVCFPLDVKPKGPLFFW 120

  Fly   151 --LYYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFP--NLLNNF 211
              ::||||:.||.||:..:|.|...::::||||||:...:..::   :|....:.||  .:||:.
plant   121 AQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYHHATVVILCYL---WLRTRQSMFPVGLVLNST 182

  Fly   212 VHVCMYFYYMMAAMG--PEYAKFLWWKKYMTELQIAQFVL-----CIFHTLRALFSNQC------ 263
            |||.||.||.:.|:|  |:      |||.:|..|:.||..     ..:......|.:.|      
plant   183 VHVIMYGYYFLCAIGSRPK------WKKLVTNFQMVQFAFGMGLGAAWMLPEHYFGSGCAGIWTV 241

  Fly   264 QFSKFISALLLLNASIFFCLFMNFYMQSYRKT 295
            .|:...:|.||       .||.||:.::|.||
plant   242 YFNGVFTASLL-------ALFYNFHSKNYEKT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 73/289 (25%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.