DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and ELOVL6

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:287 Identity:84/287 - (29%)
Similarity:133/287 - (46%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NYTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRR-- 98
            |.:.|..:.|:. |:.:.:..|.:: :.|:...:|...|:|.:::.. |...|..|..|:||:  
Human     2 NMSVLTLQEYEF-EKQFNENEAIQW-MQENWKKSFLFSALYAAFIFG-GRHLMNKRAKFELRKPL 63

  Fly    99 -----TLVVYNAFQVALSG-YMFYEHLMAGWLNYYNLKCQPVD--YSDSPSSKRMLNLCYLYYLS 155
                 ||.|::.|....:| ||.|..:..|      ||....|  :.:.|.||..   .|.:.||
Human    64 VLWSLTLAVFSIFGALRTGAYMVYILMTKG------LKQSVCDQGFYNGPVSKFW---AYAFVLS 119

  Fly   156 KLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYY 220
            |..|..||:|.:|||:  ::.:||.|||....|.:|...|.:..|...|.. :|..||..||.||
Human   120 KAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMT-MNYGVHAVMYSYY 181

  Fly   221 MMAAMG----PEYAKFLWWKKYMTELQIAQFVL-CIFHTLRALF----SNQC--QFSK-FISALL 273
            .:.|.|    .::|.|:      |..||.|.:: |:.:.|  :|    .:||  .|.. |.|:|:
Human   182 ALRAAGFRVSRKFAMFI------TLSQITQMLMGCVVNYL--VFCWMQHDQCHSHFQNIFWSSLM 238

  Fly   274 LLNASIFFC-LFMNFYMQSYRKTKAAQ 299
            .|:..:.|| .|...|:...|||..|:
Human   239 YLSYLVLFCHFFFEAYIGKMRKTTKAE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 75/255 (29%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.