DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and elovl8a

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001070061.1 Gene:elovl8a / 767653 ZFINID:ZDB-GENE-060929-240 Length:268 Species:Danio rerio


Alignment Length:261 Identity:115/261 - (44%)
Similarity:165/261 - (63%) Gaps:7/261 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLV-IGPLFMRDRKPFQLRRTLVVYN 104
            :|..|:.:.|: ||.|...:.|:..|:...|:...||  |:| .||..|..|:|..::..|::||
Zfish    12 LQILYERILEN-GDKRTDGWLLVYSPLPVGGIFLCYL--VMVWFGPKLMVHREPVNIQALLIIYN 73

  Fly   105 AFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLR 169
            ...|.||.|||||..::.||..|:|.||||||:::|...||..:|:.:|.||:.|.||||||:||
Zfish    74 FSMVCLSAYMFYEFTVSSWLASYSLLCQPVDYTENPLPMRMARVCWWFYFSKVIELADTMFFILR 138

  Fly   170 KKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLW 234
            ||::|:|:||||||.......|..||::|||.:....|:|:||||.||.||.:||:||:..|:||
Zfish   139 KKNNQLTFLHVYHHGTMIFNWWAGVKYVAGGQSFLIGLINSFVHVVMYMYYGLAALGPQMQKYLW 203

  Fly   235 WKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSY--RKTKA 297
            ||:|:|.||:.||.:...||...|::: |.|...::.::|..|.....||.|||.|||  :|||.
Zfish   204 WKRYLTSLQLLQFFIVTIHTAFNLYAD-CDFPDSMNMVVLGYALSLIALFSNFYYQSYLSKKTKL 267

  Fly   298 A 298
            |
Zfish   268 A 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 105/235 (45%)
elovl8aNP_001070061.1 ELO 35..266 CDD:279492 105/233 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.