DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33110 and Elovl7

DIOPT Version :9

Sequence 1:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:285 Identity:117/285 - (41%)
Similarity:170/285 - (59%) Gaps:14/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVV 102
            |....|:|....:| .|||.:.:.||..|:....::.:|:.:|..:||..|.:||||:|::.::.
Mouse     7 TSRTVRFYDNWIKD-ADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMIT 70

  Fly   103 YNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFV 167
            ||.|.|..|.||.||.:|:||...|:.:|..||||.||.:.||::.|:|||.||..|..||:|||
Mouse    71 YNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFV 135

  Fly   168 LRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKF 232
            ||||:||:|:|||:||::.|...|..|||.|||..||...||..|||.||.||.:.||||.|.|:
Mouse   136 LRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKY 200

  Fly   233 LWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLN-ASIFFCLFMNFYMQSYRKTK 296
            |||||::|.||:.||||...|..:..|...|.:...:...:::: ..||..||::|:.::|.|  
Mouse   201 LWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTK-- 263

  Fly   297 AAQQLQQQQQQQKQQQQLDATPCKA 321
                      .|:..:.|:...||:
Mouse   264 ----------GQRLPKTLENGNCKS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33110NP_788716.1 ELO 61..294 CDD:279492 105/233 (45%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 107/250 (43%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.